This is a working overview of reconstitution, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-11-28. Anything still debated is marked as such rather than presented as settled.
Quality control for lyophilized products includes appearance, cake structure, reconstitution time, pH, residual moisture, and potency. Residual moisture is a key attribute because excess water can reduce stability, while excessively low moisture may cause structural changes or aggregation in some systems. Stability studies compare real-time and accelerated conditions to estimate shelf life. Analytical methods must be validated for the specific matrix, container, and moisture range. Sterility and container integrity are also monitored for sterile products.
Handling practices aim to prevent moisture ingress and mechanical damage. Vials should remain stoppered and crimped until use, and reconstitution should follow the labeled diluent and volume. Shipping may involve temperature-controlled containers and desiccants, but direct contact between desiccant and product is avoided. Regulatory guidance expects documented storage conditions, excursion assessments, and stability commitments. Open questions remain about how best to predict long-term stability from short accelerated studies for every formulation class.
Stability of a lyophilized solid depends on water content, temperature, and the physical state of the formulation. Amorphous products may slowly absorb moisture and drop below their glass transition temperature, causing collapse or crystallization. Some proteins and peptides can aggregate even in a dry state, especially when exposed to heat or moisture. Accelerated stability studies at elevated temperature and humidity help estimate shelf life, but real-time data remain the basis for expiration dating.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture and oxygen exposure. The container closure system matters because stoppers and seals can allow moisture ingress over time. Storage conditions are selected from stability studies that track potency, cake appearance, and reconstitution behavior. Many freeze-dried materials are kept at controlled room temperature, while some require refrigeration or protection from light.
Quality control for freeze-dried forms includes visual inspection, water content measurement, and reconstitution time. A satisfactory cake is typically uniform, porous, and intact, although minor shrinkage or cracking may be acceptable if specifications allow. Karl Fischer titration, thermal gravimetric analysis, and near-infrared spectroscopy are used to measure water content. Reconstitution is assessed by adding a specified diluent and recording the time and ease of dissolution. Microbiological and particulate tests are added when the product is sterile or intended for injection.
| Property | Value | Notes |
|---|---|---|
| Typical appearance | White to off-white porous cake or powder | Color and structure vary with formulation. |
| Typical reconstitution time | Seconds to several minutes | Diluent, agitation, and temperature affect rate. |
| Typical storage temperature | 2–8 °C, 15–25 °C, or ≤−20 °C | Product-specific; protect from moisture and light. |
| Typical container closure | Glass vial with rubber stopper and crimp seal | Closure must limit moisture ingress. |
| Typical stability indicator | Residual moisture, potency, and reconstitution time | Monitored throughout shelf life. |
Quality control for freeze-dried lots combines visual inspection with instrumental tests. Cake appearance, color, and shrinkage are recorded against a reference, while residual moisture is measured by Karl Fischer titration or loss on drying. Thermal analysis can reveal phase transitions and crystallization events, and X-ray diffraction distinguishes amorphous from crystalline solids. Microbiological tests and container closure integrity checks are also routine for sterile products. Analytical methods must be validated for the matrix, because excipients and low moisture can affect accuracy. Open questions include how best to predict long-term stability from short-term data.
Lyophilized solids are often hygroscopic, so handling occurs in controlled low-humidity areas or glove boxes when the material is exposed. Vials remain sealed with elastomeric stoppers and aluminum crimps until use, because airborne moisture can raise residual water and shorten shelf life. The porous cake is fragile and may crack, shrink, or powder during transport. Personnel typically avoid repeated warming and cooling of sealed units, which can draw moisture through closures. These practices aim to preserve the low water content achieved during drying.
Stability studies examine how temperature, humidity, and time influence a lyophilized product. Accelerated conditions provide early information about degradation pathways, while long-term studies support shelf-life claims. The glass transition temperature of the dried formulation can indicate its physical stability, and storage above this temperature may increase molecular mobility and lead to collapse or aggregation. Container closure integrity also matters because moisture or oxygen ingress can degrade the product, so vial stoppers and seals are part of the quality system.
Handling and storage practices aim to keep the cake intact and dry. Vials are typically stored upright at controlled temperatures, often between 2 °C and 8 °C or at -20 °C for longer-term use. Reconstitution involves adding a suitable diluent and gently mixing until the solid dissolves. Shaking or rapid injection of diluent can create foam or damage sensitive molecules. Once reconstituted, the product may require refrigeration and use within a defined period.
Residual moisture is a key quality attribute for lyophilized products. Water that remains after secondary drying can affect chemical stability, cake structure, and shelf life. Karl Fischer titration is a common method for measuring water content in the dried solid. The target range varies by product, but many biologics are dried to between 0.5% and 3% water by weight. Acceptable limits are set during development and confirmed by stability studies.
=== Protease inhibition === Approximately two-thirds of human serpins perform extracellular roles, inhibiting proteases in the bloodstream in order to modulate their activities. For example, extracellular serpins regulate the proteolytic cascades central to blood clotting (antithrombin), the inflammatory and immune responses (antitrypsin, antichymotrypsin, and C1-inhibitor) and tissue remodelling (PAI-1). By inhibiting signalling cascade proteases, they can also affect development. The table of human serpins (below) provides examples of the range of functions performed by human serpin, as well as some of the diseases that result from serpin deficiency. The protease targets of intracellular inhibitory serpins have been difficult to identify, since many of these molecules appear to perform overlapping roles. Further, many human serpins lack precise functional equivalents in model organisms such as the mouse. Nevertheless, an important function of intracellular serpins may be to protect against the inappropriate activity of proteases inside the cell. For example, one of the best-characterised human intracellular serpins is Serpin B9, which inhibits the cytotoxic granule protease granzyme B. In doing so, Serpin B9 may protect against inadvertent release of granzyme B and premature or unwanted activation of cell death pathways. Some viruses use serpins to disrupt protease functions in their host. The cowpox viral serpin CrmA (cytokine response modifier A) is used in order to avoid inflammatory and apoptotic responses of infected host cells.
Argentation chromatography is chromatography using a stationary phase that contains silver salts. Silver-containing stationary phases are well suited for separating organic compounds on the basis of the number and type of alkene groups. The technique is employed for gas chromatography and various types of liquid chromatography, including thin layer chromatography. Analytes containing alkene groups elute more slowly than the analogous compounds lacking alkenes. Separations are also sensitive to the type of alkene. The technique is especially useful in the analysis of fats and fatty acids, which are well known to exist in both saturated and unsaturated (alkene-containing) forms. For example, trans fats, undesirable contaminants in ultra-processed foods, are quantified by argentation chromatography.
Bobby's Vegas Gamble – Covers the opening of Mesa Grill Las Vegas. Restaurant Revamp – Flay tries to help a family restaurant. Chefography: Bobby Flay – Biography of Flay's life and career. Tasting Ireland – Flay takes a food tour of Ireland, his ancestral homeland. Food Network Awards – The Food Network recognizes people and places that have impacted the food world. All-Star Grill Fest: South Beach – Flay joins Paula Deen, Giada De Laurentiis, Alton Brown, and Tyler Florence for a barbecue. In October 2021, Variety reported that Flay would leave Food Network after a 27-year run, after he and the network failed to reach an agreement on a new contract. People reported that Flay had sought $100 million as part of the proposal. In November 2021, it was reported that Flay had signed a new three-year deal with Food Network.
Automated insulin delivery systems are automated (or semi-automated) systems designed to assist people with insulin-requiring diabetes, by automatically adjusting insulin delivery in response to blood glucose levels. Currently available systems (as of October 2020) can only deliver (and regulate delivery of) a single hormone—insulin. Other systems currently in development aim to improve on current systems by adding one or more additional hormones that can be delivered as needed, providing something closer to the endocrine functionality of the pancreas. The endocrine functionality of the pancreas is provided by islet cells which produce the hormones insulin and glucagon. Artificial pancreatic technology mimics the secretion of these hormones into the bloodstream in response to the body's changing blood glucose levels. Maintaining balanced blood sugar levels is crucial to the function of the brain, liver, and kidneys. Therefore, for people with diabetes, it is necessary that the levels be kept balanced when the body cannot produce insulin itself. Automated insulin delivery (AID) systems are often referred to using the term artificial pancreas, but the term has no precise, universally accepted definition. For uses other than automated insulin delivery, see Artificial pancreas (disambiguation).
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Sources: en.wikipedia.org
Blockage of voltage-dependent sodium channels (after activation of the channel, diclofenac inhibits its reactivation, also known as phase inhibition) Blockage of acid-sensing ion channels (ASICs) Positive allosteric modulation of KCNQ- and BK-potassium channels (diclofenac opens these channels, leading to hyperpolarization of the cell membrane) The duration of action (i.e., duration of pain relief) of a single dose is longer (6 to 8 h) than the drug's 1.2–2 h half-life. This may be partly due to its persistence for over 11 hours in synovial fluids.
== Clinical trial == The National Institutes of Health announced on 27 February 2015 the commencement of a randomized controlled trial of ZMapp to be conducted in Liberia and the United States. From March 2015 through November 2015, 72 individuals infected with the Ebola virus were enrolled in the trial; investigators stopped enrolling new subjects in January 2016, having failed to reach its enrollment goal of 200 due to the waning of the Ebola outbreak. As a result, although a 40% lower risk of death was calculated for those who received ZMapp, the difference was not statistically significant and ultimately it could not be determined whether the use of ZMapp was superior to the optimized standard of care alone. However, ZMapp was found to be safe and well tolerated.
== Toxicity == One review on graphene toxicity published in 2016 by Lalwani et al. summarizes the in vitro, in vivo, antimicrobial and environmental effects and highlights the various mechanisms of graphene toxicity. Another review published in 2016 by Ou et al. focused on graphene-family nanomaterials (GFNs) and revealed several typical mechanisms such as physical destruction, oxidative stress, DNA damage, inflammatory response, apoptosis, autophagy, and necrosis. A 2020 study showed that the toxicity of graphene is dependent on several factors such as shape, size, purity, post-production processing steps, oxidative state, functional groups, dispersion state, synthesis methods, route and dose of administration, and exposure times. In 2014, research at Stony Brook University showed that graphene nanoribbons, graphene nanoplatelets, and graphene nano–onions are non-toxic at concentrations up to 50 μg/ml. These nanoparticles do not alter the differentiation of human bone marrow stem cells towards osteoblasts (bone) or adipocytes (fat), suggesting that at low doses, graphene nanoparticles are safe for biomedical applications. In 2013, research at Brown University found that 10 μm few-layered graphene flakes can pierce cell membranes in solution. They were observed to enter initially via sharp and jagged points, allowing graphene to be internalized in the cell. The physiological effects of this remain unknown, and this remains a relatively unexplored field.
=== Agmatine and polyamines === The decarboxylation of arginine by arginine decarboxylase produces agmatine, which functions as a neuromodulator and serves as an alternative precursor for the synthesis of polyamines. In mammals, these are essential for various post-translational modifications, including those involving histones. Agmatine can be converted into N-carbamoylputrescine and subsequently into putrescine. Alternatively, putrescine is formed by decarboxylation of ornithine. Putrescine can then be converted into spermidine and subsequently into spermine, the other polyamines. The relative contributions of agmatine and ornithine to putrescine formation are not yet fully understood. Various plant alkaloids, such as nicotine and the tropane alkaloids cocaine, hyoscyamine, and scopolamine, are synthesized in plants from putrescine. This compound is usually derived from ornithine but can also originate from arginine. Likewise, homospermidine, a precursor of the pyrrolizidine alkaloids (e.g., senecionin), is formed from arginine or ornithine via putrescine. Both arginine and ornithine can be converted into putrescine in bacteria. The pathway utilized depends on whether arginine is converted into ornithine or metabolized via alternative routes, as well as on its availability. Prokaryotes possessing arginine decarboxylase include enterobacteria, mycobacteria, and representatives of Aeromonas and Pseudomonas.
== Analysis == The chemical analysis of fatty acids in lipids typically begins with an interesterification step that breaks down their original esters (triglycerides, waxes, phospholipids etc.) and converts them to methyl esters, which are then separated by gas chromatography or analyzed by gas chromatography and mid-infrared spectroscopy. Separation of unsaturated isomers is possible by silver ion complemented thin-layer chromatography. Other separation techniques include high-performance liquid chromatography (with short columns packed with silica gel with bonded phenylsulfonic acid groups whose hydrogen atoms have been exchanged for silver ions). The role of silver lies in its ability to form complexes with unsaturated compounds.
Sources: en.wikipedia.org
Collapse occurs when the product temperature rises above its collapse or eutectic temperature during drying. The frozen matrix loses structure, producing a shrunken or melted appearance. This can slow reconstitution and may affect stability.
Karl Fischer titration is a common method, along with loss on drying and thermogravimetric analysis. Each method has different sensitivity and sample requirements. Results should be interpreted with the product's formulation and container in mind.
No. Lyophilization removes water but is not a sterilization step. Sterile products are typically filtered and filled aseptically before freezing, and container closure integrity is maintained afterward.
Sealed vials or containers should be kept at the temperature specified by stability data, often controlled room temperature or 2–8 °C. Moisture and oxygen barriers are important because both can degrade sensitive materials. Opened containers may need immediate use or protection from ambient humidity.